In silico design of Antimalarial drug from Catharanthus roseus (G. Don)alkaloid molecules against AMA1 protein


Manoj Joshi and Chetana Suvalka*

Department of Zoology, Sangam University, Bhilwara, Rajasthan, India

Corresponding Author E-mail:chetanasuvalka0408@gmail.com

DOI : http://dx.doi.org/10.13005/bbra/3470

Download this article as:  PDF

ABSTRACT:

The emergence and spread of drug resistance in Plasmodium falciparum, the parasite causing the most severe form of malaria is a major threat to malaria control and elimination program around the globe. With Plasmodium falciparum having evolved widespread resistance against a number of previously widely used drugs, currently artemisinine and its derivatives are the cornerstones of first line treatment of uncomplicated malaria. Growing incidences failure reflects artemisinine resistance. Pharmacology approach in this study is being used against AMA1 protein which can be used as major target for drug due to its participation in erythrocytic infection stage. This protein is conserved in all plasmodium  species. The AMA1-PLAF8 structure is modelled through homology modelling method and virtual screening against Catharanthus roseus fraction is carries out using Maetrso. Secologanin,Vindoline,tabersonine,Vincristine,Serpentine, Ajmalicine,Catharanthine and catechol were taken for screening. Secaloganine showed the best binding results with lowest binding energy (-7.815 Kcal/mol) and shortest bond length i.e. 1.80881 Ǻ. This virtual screening investigation suggests that Secaloganin can be repurposed for malaria control and prevention.

KEYWORDS:

Apical Membrane Antigen 1 (AMA 1); Artemesinine resistance; Malaria; Molecular docking; XP Gscore

Introduction          

Malaria keeps on causing unsuitably significant degrees of illness and demise, as archived in progressive versions of the World Malaria report.1 As indicated by the most recent report, there were an expected 627000 lives lost in malaria 2020.2 Malaria is preventable and treatable and the worldwide need is to lessen the weight of infection and demise while holding the drawn out vision of Malaria destruction.

The only malaria vaccine, RTS,S/AS01, initiates incomplete adequacy through enlistment of antibodies against the sequence (Asn-Ala-Asn-Pro) of the circumsporozoite protein (CSP). However, there are many antigenic determinants of Plasmodium against which either medications or antibodies are formed. 3 The different standards for antigen choice as well as medication definition are summed up in table.1.

Table 1: Plasmodium exposed surface antigens are:

S.No. Protein ID  Protein name Protein function
1.       IPR010901 Merozoite Surface 1, C-terminal C-terminal region of merozoite surface protein 1 which helps in invasion of Red Blood Cells.4
2.       IPR010423 Ookinete Surface antigen, EGF domain Pvs25 and Pvs28  antigenic proteins present on surface of Plasmodium.5
3.       IPR032761 Plasmodium falciparum erythrocyte membrane protein1,N terminal Protein domain present on Plasmodium falciparum infected erythrocytes to adhere host endothelial receptors.6
4.       IPR003067 Plasmodium Circumsporozoite Protein Surface antigen on surface of sprozoite of Plasmodium  which is passes from mosquito vector to mammalian host.7
5.       PF12319 Tryptophan-Threonine-rich plasmodium antigen C terminal C terminal of the surface antigen present on Plasmodium.8
6.       PF07462 Merozoite surface protein 1 (MSP1) C-terminus Represent C terminal region of merozoite surface protein 1 which induces merozoite infection to Red Blood Cells.9
7.       IPR029210 Plasmodium falciparum erythrocyte membrane protein-1,N terminal segment Protein domain present on Plasmodium falciparum infected erythrocytes to adhere host endothelial receptors.10
8.       IPR006373 Variant surface antigen Rifin RIFIN Expressed on free merozoites as well as on infected erythrocytes contributing to antigenic variation capacity of the parasite.11
9.       IPR010784 Merozoite surface protein type Merozoite invasion to erythrocytes involves multiple interaction with Merozoite Surface Protein.4
10.    PF15445 Acidic terminal segments, variant surface antigen of PfEMP1 These proteins help in evading host immune system by sticking to endothelial cells.
11.    PF06247 Pvs28 EGF domain Group of okinete surface protein  and induces immune responses in body
12.    IPR006499 Reticulocyte binding protein These are reticulocyte binding protein which express Duffy antigen
13.    PF03805 Cytoadherence linked asexual protein Induces binding of Pf  to host endothelial cells
14.    PF15448 N terminal segments of Plasmodium falciparum erythrocyte membrane protein This is a transmembrane protein that shares domains with molecules expressed on infected erythrocytes
15.    PF07133 Merozoite surface protein (SPAM) It is a platform for binding to human erythrocytes by Plasmodium falciparum
16.    IPR003298 Apical membrane antigen 1 Expressed on invasive merozoite which are causative agent of malaria
17.    IPR026894 DNAJ containing protein, X domain This domain is found in Plasmodium falciparum  ring infected erythrocyte surface antigen and is shown to bind to spectrin and stabilize tetramer.12
18.    IPR024056 Apical membrane antigen 1 (AMA-1) domain superfamily AMA-1  appears to be transported to the merozoite surface close to the time of schizont rupture.13
19.    IPR005553 Cytoadherence Linked Asexual Protein (CLAP) CLAP is found to be associated in binding of P.falcipaprum infected erythrocytes to host endothelial cells.
20.    IPR010884 6-Cysteine (6-Cys) domain 6-Cys domain is found in Plasmodium  proteins that are expressed in all stages of parasite life in both vertebrate and mosquito hosts.14
21.    PF02009 RIFIN (Repeated Interspersed families) These are expressed on the surface of infected erythrocytes.15
22.    PS50095 PLAT (Polycystin-1, lipoxygenase and alpha toxin) domain profile It is involved in protein-protein, protein-lipid interaction. In P.falciparum it is expressed on surface of gametocyte and interacts with mammalian triglyceride lipase.16
23.    PS50092 Thrombospondin type-1 (TSP1) repeat profile It is present in circumsporozoite protein of Plasmodium.17
24.    PF15447 N terminal segments of PfEMP1 It is variable part of the variant surface antigen family Plasmodium falciparum and adhere to host endothelial receptors.18
25.    IPR043226 Neural cytotoxicity triggering receptor 3 It stimulates NK cells cytotoxicity.
26.    IPR009484 Protein of unknown function DUF1103 This family function is unknown.
27.    IPR014886 La protein, xRRM domain La protein motifs are generally involved in binding to UUU-3’OH sequence of various RNA Polymerase III where xRRM domain induces conformational changes.19
28.    IPR034204 Subtilisin SUB1-like catalytic domain It activates the merozoite surface protein allows it to bind to host erythrocyte membrane prior to egress.20
29.    PS50234 VWFA domain profile Von Willebrand Factor (VWF) is a large multimeric protein required for normal hemostasis.21
30.    IPR036383 Thrombospondin type-1(TSP1) repeat superfamily These are multimeric glycoprotein that function at cell surfaces and in extracellular matrix.22

The current situation is confronting many difficulties in vector control and parasite disposal. One of the most significant challenges is drug obstruction in Plasmodium. While obstruction is regularly evaluated by drug adequacy concentrates on that uncover applicant point transformations, whose pervasiveness are checked. The genuine method of activity of obstruction is related with changes which are frequently less clear. Notwithstanding, a significant comprehension of the sub-atomic instrument hidden medication opposition can prompt the improvement of new synthetic mixtures that can re-establish drug productivity. Witnessing the need for antimalarial drug, there is need of virtual screening of some potential drug candidates to push them up for further trials.

Catharanthus roseus is an important medicinal plant of family Apocynaceae with 70 different types of alkaloids, steroids and chemotherapeutic agents which are effective as anticancerous, antimalarial and antimicrobial activity. Vinblastine and Vincristine are two important alkaloids that are being used widely to treat diabetes.23 Catharanthus roseus (L.) G. Don contains terpenes and alkaloids which exhibits great pharmacological activities. 24 It has wide range of medicinal properties such as antioxidant, 25-27 anticancer, 28 antidiabetic, 29 antimicrobial,30 antiulcer,23 hypertensive,24,31 wound healing, 31 hypolipidemic 27 and memory enhancement. 28,29 With virtual screening the objective is to explore antimalarial effect of various alkaloid fractions of the plant.

Figure 1: Source: KEGG Malaria – Reference pathway – hsa pathogen

Click here to view Figure

Table 2. Antimalarial drugs are classified on basis of its target:

S.No. Mode of action Target  Site   Type of drug
1.  Depending on stage of plasmodium it affects Tissue Schizocidal Primary Tissue forms a.      Sulfodoxine + Pyrimethininb.     Proguanil

c.      Atrovaquine

d.     Primaquine

Latent Tissue Forms(Hyphozoites) a.      Primaquineb.     Tafenoquine
Blood Schizontocidal Rapid action a.      Chloroquineb.     Artemesinin derivative

c.      Quinine

d.     Mefloquine

e.      Atoquine

f.      Amodiaquine

g.     Lumefantrine

Slow action a.      Proguanilb.     Pyrimethamine + Sulfadoxine

c.      Clirdomycin

Gametocidal a.      Artemesininb.     Primaquine

c.      Chloroquine and Quinine

2

Depending on clinical indications Causal prophylaxis No drugs for sporozoite from, these drugs will inhibit pre-erythrocytic stage
Suppressive prophylaxis a.      Chloroquineb.     Mefloquine

c.      Doxycycline

Clinical cure a.      Chloroquineb.     Artemesinin derivative

c.      Quinine

d.     Mefloquine

e.      Atoquine

f.      Amodiaquine

g.     Lumefantrine

d.     Proguanil

e.      Pyrimethamine + Sulfadoxine

h.     Clirdomycin

To prevent relpase a.      Primaquine
Transmission to mosquitoes a.      Primaquine

Table 3: Antimalarial drugsdivided on basis of groups

S.no. Group Type of drug
1. Quinoline derivative a.      Chloroquine
b.     Quinine
c.      Atroquine
d.     Primaquine
e.      Mefloquine
f.      Tefloquine
2. Artemesinin Artemesinin derivative a.      Dihydroartemesininb.     Artemether

c.      Artesunate

d.     artether

Synthetic a.      Arteolane
3. Aryl alcohol derivative a.      Lumefantrine
4. Antifolates a.      Pyrimethamineb.     Sulfodoxine

c.      Doprone

d.     Proguanil

5. Antimicrobials a.      Tetracyclinb.     Clindamycin

The potential drugs and their mechanism of action is summarized in table 2, however, the effect and targets of various drugs is summarized in table 3. There are no medications for sporozoite form; the causal prophylaxis drugs repress erythrocytic stage. The suppressive prophylaxis acting medications smother clinical infection beginning. Primaquine is the main medication which targets hyphozoites of P.vivax and P.ovale as well as gametocytes of Plasmodium.

Following treatments are used to treat uncomplicated P. falciparum malaria (2015) Treating children and adults with uncomplicated P. falciparum malaria (except pregnant women in their first trimester) with one of the following ACTs:

artemether + lumefantrine

artesunate + amodiaquine

artesunate + mefloquine

dihydroartemisinin + piperaquine

artesunate + sulfadoxine-pyrimethamine (SP).

The current situation is confronting many difficulties in vector control and parasite elimination. One of the recent problems in malaria elimination is Plasmodium mutants. The mutation in Kelch protein resulted in resistance. To overcome such obstructions drug designing against target protein is been done to overcome future problem of resistance. As changes in the Kelch13 (PfK13) quality were distinguished as the vital sub-atomic markers and stayed to be key indicators of ART resistance. As far as drug delivery is concerned the most potential and safe target stage is invasion of Red Blood Cells. Regarding above fact and seeing the overview of Plasmodium infection in figure.1. Merozoite surface antigen 1,8 Plasmodium falciparum erythrocyte membrane protein 1,13 RIFIN, 15 Apical Membrane Antigen 1 are the most effective targets. However, AMA1 protein is chosen in this work because of its transmembrane nature and many unrevealed characters.13

This paper covers in silico designated drug adequacy against AMA1 protein quality and its viability to be utilized as medication in future for Malaria treatment.

Methodology

The FASTA grouping of P. falciparum for AMA 1 was recovered from the UniProt data set (https://www.uniprot.org/). The comparing UniProt ID explicitly for the P. falciparum strain utilized for this study was AMA1_PLAF8. The Protein sequence and 3D structure of PfK13 was derived from Uniprot data set.

Protein  Modelling

Protein modelled through Homology modelling method through Swiss Model. The maximum homology was 97% with searched templates, the modelled prepared by choosing best matching template and best model selected on basis of lowest RMSD value and DOPE score. The model structure was validated through Ramachandran plot.

Ligand Preparation

The small molecule library was built based on a wide range of experimental activity against P. falciparum. Molecular preparations such as the insertion of hydrogen bonds, 2D to 3D conversion, stereoisomers production, neutralisation of charged structures, or identification of most likely ionisation state at a user-defined pH, and the entire preparation were carried out using Maestro’s LigPrep application.32

Protein preparation

Because the protein was simulated, the YASARA Energy Minimisation Server was used to perform an energy minimisation (Krieger et al. 2009)33. This minimised protein was then used in the Protein Wizard tool for further processing. Using Maestro’s Glide application, the receptor grid with given grid coordinates of X = -20, Y = -10, and Z = 0 was produced with a box size of 36 × 36 × 36 Å. 33

Molecular Docking

The produced ligand library was then docked with the protein grid using Glide’s XP (extra precision) docking function, yielding an XP Glide score as a consequence. To rank docking poses and determine protein–ligand binding affinities, the XP Glide scoring function is utilised. Using a “funnel-type” method, the Glide algorithm searches for the ligand’s position, orientation, and conformation in the enzyme’s active site. 34 Maestro’s Pose viewer & XP-visualizer software was used to analyse the output files.

Protein FASTA sequence

QKY59679.1 AMA1MKSSNTKMQCIVKKLSLLAMPVVIAAILSLKIVPAGAAFVAFQTDPPSSRGNRRSSRGGRNQQAAGRQAQNEA EGTERAGGR SSSSKIIQQTPWTKYMIKYDIARCHGSGIYVDMGGYEAIGGKHYRMPIGKCPVMGKVINLASGADFLEPISADNPRYRGLGFPETVLK HTGALAGALTGTANNAINLSPVSAEDLRKWGYKGNPVTNCAEYANNIVPGSDTRTKYRYPFVYDGKDELCYVLYSPMQYNQGSRYC DADGSLEEGPSSLLCMKPYKSDLDAHLYYGSSRIDPKWDVNCPMSPIRDAIFGKWVSGACVALESAFEEFVNSAEECASILFENSATDID VDVDAEGYNEINELYSGLKNLQLKQIAFSLFAPMSKSAATAKLSKGVGKNWANYESNLGICRILSETPTCLIINAGSLAMTALGSPLESDA INFPCDIDTVGYVEPRTRNGENGESRFPVTTALSIKTLKCTKYVHSKYSESCGTYYYCSEEKSSYLSRLYQFLSNHSVKKAMAITAALLALIF AIYWVYRRLYTTKIRREHEDYDRLMSKYEYDDVSHAVSEPEQQLKTDAYIWGEAAARPSDITPVHLTKLN

Figure 2: Model prepared through modeller     

 

Click here to view Figure

Figure 3: Superimposing modelled structure with template 6n87     

Click here to view Figure

Table 4: XP Gscore and drug targets

S.no. PDB DRUG ID (PubChem) XP GScore
  ID: CHEMBL1235867  
Name: SECOLOGANIN
Max Phase: 0 Research
Molecular Formula: C17H24O10
Molecular Weight: 388.37
ChEMBL Synonyms: Secologanin
Molecule Type: Small molecule
2. Vindoline ID: CHEMBL526546 -4.734
Name: VINDOLINE
Max Phase: 0 Research
Molecular Formula: C25H32N2O6
Molecular Weight: 456.54
ChEMBL Synonyms: Vindoline
Molecule Type: Small molecule  
3. Ajmalicine ID: CHEMBL1604074 -6.230
Name: Ajmalicine
Max Phase: 0 Research
Molecular Formula: C21H24N2O3
Molecular Weight: 352.43
Molecule Type: Small molecule 
4. Serpentine ID: CHEMBL3559488 -6.286
Name: Serpentine
Max Phase: 0 Research
Molecular Formula: C21H21N2O3+
Molecular Weight: 349.41
Molecule Type: Small molecule
5. Catharanthine base ID: CHEMBL2163793 -3.847
Name: CATHARANTHINE BASE
Max Phase: 0 Research
Molecular Formula: C21H24N2O2
Molecular Weight: 336.44
ChEMBL Synonyms: Catharanthine Base
Molecule Type: Small molecule
6. Vincristine ID: CHEMBL90555 -5.899
Name: VINCRISTINE
Max Phase: 4 Approved
Molecular Formula: C46H56N4O10
Molecular Weight: 824.97
7. Tabersonine ID: CHEMBL2011511 -4.990
Name: TABERSONINE
Max Phase: 0 Research
Molecular Formula: C21H24N2O2
Molecular Weight: 336.44
ChEMBL Synonyms: Tabersonine  
Molecule Type: Small molecule
8. Catechol ID: CHEMBL280998 -3.622
Name: CATECHOL
Max Phase: 0 Research
Molecular Formula: C6H6O2
Molecular Weight: 110.11
ChEMBL Synonyms: Pyrocatechol
Molecule Type: Small molecule
9. Artemesinin ID: CHEMBL567597 -3.226
Name: ARTEMISININ
Max Phase: 4 Approved
Molecular Formula: C15H22O5
Molecular Weight: 282.34
ChEMBL Synonyms: (+)-Artemisinin ARTEMISININGNF-PF-5341 NSC-369397
Trade Names: Artemisin
Molecule Type: Small molecule
Table 5: Structures of all compounds taken from PubChem

Click here to view Figure

Figure 4: Showing docking pose of A. Secologanin, B. Serpentine, C. Ajmalicine, D. Vincristine, E. Tabersonine, F. Vindoline, G. Catharanthine, H. Catechol, I. Artemisinine

Click here to view Figure

Figure 5: Showing protein ligand binding of A. Secologanin , B. Serpentine, C. Ajmalicine, D. Vincristine ,E. Tabersonine , F.Vindoline  G. Catharanthine, H. Catechol ,I. Artemisinine

Click here to view Figure

Table 6: Details of the ligand protein interactions and participating amino acids

S.No. Name of Compound Participating residues Bond length(Ǻ) Backbone/ Sidechain Donar angle Acceptor angle Binding energy(Kcal/mol)
1. Secaloganin Chain A: LYS  149 1.80881 Backbone 162.125 159.578 -7.815
Chain B: LYS 149Chain B :GLN 147 1.77052.00271 SidechainBackbone 129.785178.615 150.832
2. Serpentine Chain A: LYS 149 1.82641 Backbone 171.464 -6.286
Chain A: LYS 149 2.02224 Backbone 148.236
3. Ajmalicine Chain A: PRO 218Chain A: LYS 149 1.84322.38055 BackboneBackbone 131.325109.751 162.126 -6.230
Chain B:LYS 149 2.12241 Backbone 145.232
4. Vincristine Chain A: LYS  149 2.16061 Sidechain 168.287 -5.899
Chain B: GLN 147 2.36326 Backbone 141.045 123.219
5. Vindoline Chain B : GLN147 2.03706 Backbone 142.347 173.627 -4.734
In chain B: LYS 149 1.911687 Sidechain 124.405
6. Tabersonine -4.99
7. Catharanthine base LEU 221 2.09897 Backbone 153.093 -3.847
8. Catechol Chain A :LYS 149 2.003264 Backbone 158.85 149.116 -3.662
Chain A :LYS 149 2.02838 Sidechain 119.466
Chain B :GLN 147 2.02045 Backbone 151.825 162.144
9. Artemisinine Chain A  :LYS 149 2.0194 backbone 108.321 -3.226

Results

Protein FASTA sequence downloaded from NCBI, BLASTp done with protein datasets. The maximum similarity was found to be 97% which suggests that homology modelling method can be used. Swiss Model software was used for searching best matched templates and best identical template was then used for preparing AMA1 model. 6n87 was found to be best match sequence and used as template for building model. Modeller was also used for building the model. Best model was selected among various models prepared on basis of DOPE score. The best model showed DOPE score -20753.71484 (Fig. 2). The modelled structured was validated by superimposing it with best match templates on basis of Root Mean Square Deviation (RMSD) which was found to be 1.65764 (Fig. 3). The structure was validated with Ramachandran plot, the plot statistics reveal that 82.6% of the residues of modelled structure were in favourable region and additional 15% were in allowed region. Only 0.7% of the residues were in disallowed region. More than 97% of the structure was in allowed regions which shows the modelled protein was good enough to carry out virtual screening. For virtual screening by using Glide’s XP (extra precision) docking function. The results were analysed by Maestro’s Pose viewer and XP- visualize software. YAARA energy minimization serevr was used to perform energy minimization.  Catharanthus roseus alkaloid fraction molecules were used as ligands against the modelled protein. Secaloganin showed Hydrogen bonding with chain A and chain B with Lysine 149 and Glutamine 147 (Fig.5 A). The shortest length H- bond is formed with Lysine 149 of Chain A of bond length 1.80881 Å. Serpentine showed two H-bond with Lysine 149 with varied bond lengths (Fig.5 B). Ajmalicine showing H-bond with Porline 218 and Lysine 149 of chain A, while one more H-bond is formed between Lysine 149 of chain B (Fig.5 C). Vincristine is a known anticancerous compound showing H-bond with Lysine 215 and Glutamine 147 of chain A and B (Fig. 5 D) respectively. Tabersonin showing hydrophilic interactions with Leucine 187, Phenylalanine 196, proline 190 of chain B and proline 220, proline 218 and glutamine 148 of chain A (Fig. 5 E). Vindoline showing H-bond with Lysine 149 and Glutamine 147 of chain B (Fig. 5 F). Catharanthine showing H-bond with Leucine 221 (Fig 5 G). Catechol forming H-bond with Lysine 149 of chain a and Glutamine 147 of chain B (Fig. 5 H). Artemisinine which is known drug of malaria shows one H- bond with Lysine 149 of chain A (Fig. 5 I). 

Discussion

In this study alkaloid fraction of Catharanthus roseus were taken for docking against AMA protein. An extensive survey of literature related to Catharanthus roseus was conducted up to Janauary,2022. Catharanthus roseus has been of prime importance in the traditional medicine systems and has wide therapeutic applications for many centuries. During phytochemical investigation total of 344 compounds including monoterpene indole alkaloids, bisindole alkaloids, flavonoids, phenolic acids and volatile were found active against many diseases in Catharanthus roseus.35 AMA is a surface protein which is crucial for erythrocyte invasion of parasite, the AMA 1_PLAF8 structure is not revealed yet so protein modelling done through Swiss Model and structure validated by superimposing modelled protein with available templates. Catharanthus roseus is revealed for many therapeutic values but anti-malarial molecule is underinvestigation.36 Catharanthus roseus leaf and flower extract is proved to inhibit parasite 66% Megha et al, 2017. However, when pharmacology of Catharanthus roseus leaves and flowers was done, majority of alkaloids fractions were revealed. The major molecules present in Catharanthus roseus leaf and flower extract are Secologanin, Vindoline, tabersonine, Vincristine,Serpentine, Ajmalicine,Catharanthine 37 and a little fraction of catechol is been observed which is phenolflavanoid. Virtual screening is been done through Maestro and protein was simulated by YASARA energy minimization software. In virtual screening the best XP Gscore is shown by Secaloganine i.e. -7.815 Kcal/ mol while that of artemisinine is -3.226 Kcal/mol which is a known drug. Artemisinine are derived from extracts of weet wormwood and are well established for the treatment of malaria, including highly drug resistant dtrains. Its efficacy also extends to phyllogenetically unrelated parasitic infections such as schistosomiasis. In modelled protein Lysine 149 in chain A is participating in Hydrogen bond formation with secaloganin, Serpentine, Ajmalicine. Vincristine, Catechol and atremisinine. Chain Glutamine 147 is participating in hydrogen bond formation with Secaloganine, Vinscristine, Vindoline and catechol. Chain A proline 218 is participating in Hydrogen bond formation with Ajmalicine . The shortest Hydrogen bond if formed between Ajmalicine and proline 218 (1.8492 Ǻ), Chian A lysine 149 and Sepentine (1.82641 Ǻ) and Secaloganin and ChainA Lysine 149 (1.80881 Ǻ). Tabersonine is making Hydrophillic interactions with the protein’s Proline 190, Lutamine 147 pocket. Tabersonine is a monoterpenoid indole alkaloid with cytotoxic activity. It has a role as an antineoplastic agent and a metabolite.

Conclusion

The above data reveal that Secaloganine can be further taken explored as a drug molecule for antimalarial drug formulation, and chemoinformatics techniques can be used to future investigate the most stable form of the molecule in the future.

Acknowledgement

I would acknowledge the opportunity provided to me to learnt computational Biology techniques To Dr. Imran Siddiqui, Senior Scientist,  Central Drug Research Institute, Lucknow, Uttar Pradesh, India.

Funding Sources

The author(s) received no financial support for the research, authorship, and/or publication of this article.

Conflict of Interest

The authors do not have any conflict of interest.

Data Availability Statement

This statement does not apply to this article.

Ethics Statement

This research did not involve human participants, animal subjects, or any material that requires ethical approval.

Informed Consent Statement

This study did not involve human participants, and therefore, informed consent was not required.

Clinical Trial Registration

This research does not involve any clinical trials.

Permission to reproduce material from other sources

Not Applicable 

References

  1. Uhomoibhi P . Redoubling efforts to sustain seasonal malaria chemoprevention, Lancet Child Adolesc. Heal., 2022; 6( 3) :142–144. Doi- 10.1016/S2352-4642(22)00007-4
    CrossRef
  2. W. H. Organization,THE E-2020 ELIMINATING 2019 progress report, 2020.
  3. Naaz R, Anjum N, and Anjum G, is malaria an entirely preventable and treatable. 2020;8(1): 1248–1256. Doi – https://www.openacessjournal.primarydomain.in/abstract/104
  4. Senosiain G,  Kana A, Singh I, Chourasia.S,  Das B, Dodoo M , Theisen D,  Peripheral merozoite surface proteins are targets of naturally acquired immunity against malaria in both India and Ghana. Infection and Immunity. 2020 ;88(4): 10-1128. Doi- https://doi.org/10.1128/iai.00778-19
    CrossRef
  5. Jalei A, Chaijaroenkul A,  Bangchang K. Genetic Diversity of Plasmodium vivax Surface Ookinete Protein Pvs25 and Host Genes in Individuals Living along the Thai–Myanmar Border and Their Relationships with Parasite Density. Microbiology Research; 2024; 15(2): 693-707. Doi – https://doi.org/10.3390/microbiolres15020045
    CrossRef
  6. Avril M, Bernabeu M , Benjamin M , Brazier J , and Smith D.Interaction between Endothelial Protein C Receptor and Intercellular Adhesion Molecule 1 to Mediate Binding of Plasmodium falciparum : Infected Erythrocytes to Endothelial Cells.mBio. 2016; 7 (4): 00615-16. https://doi.org/10.1128/mbio.00615-16
    CrossRef
  7. Aly A , Vaughan A ,Kappe S, Malaria Parasite Development in the Mosquito and Infection of the Mammalian Host, Annu. Rev. Microbiol .2009;63( 1):195–221. Doi- https://doi.org/10.1146/annurev.micro.091208.073403
    CrossRef
  8. Fofana F, Wele M, Diabate O, Cisse C, Diawara A, Toure M, Djimde A. (2025). Advances in Malaria Vaccine Development Targeting Plasmodium falciparum Surface Proteins. Annual Research & Review in Biology40(9), 1-17. DOI: https://doi.org/10.9734/arrb/2025/v40i92300
    CrossRef
  9. Yan H, Feng J, Chen M.  Structural modelling prediction of recombinant Plasmodium falciparum K13-F446I and K13-C580Y gene by AlphaFold method and heterologous expression in Spodoptera frugiperda 9 cells. Pathogens. 2022;11(11): 1271.Doi-  https://doi.org/10.3390/pathogens11111271
    CrossRef
  10. Kardam R, Jangra A, Kumar D, Kumar V, & Sharma V. Promising Molecular Targets of Plasmodium Falciparum, the Deadliest Parasite and Their Synthetic Inhibitors: A Review. ChemistrySelect. 2025; 10(17): 202405253. Doi- https://doi.org/10.1002/slct.202405253
    CrossRef
  11. Mwakalinga S,Expression of a type B RIFIN in Plasmodium falciparum merozoites and gametes. 2012 ;11(1):1–12.Doi-  http://www.malariajournal.com/content/11/1/429
    CrossRef
  12. Pei X,The ring-infected erythrocyte surface antigen ( RESA ) of Plasmodium falciparum stabilizes spectrin tetramers and suppresses further invasion. 2007 ; 110(3) : 1036–1042. Doi- https://doi.org/10.1182/blood-2007-02-076919
    CrossRef
  13. Sun S, Segev-Zarko L,  Pintilie G,  Kim C,  Staggers Y,  Schmid R, Boothroyd M,   Cryogenic electron tomography reveals novel structures in the apical complex of Plasmodium falciparum.Mbio. 2024; 15(4): 02864-23. Doi- https://doi.org/10.1128/mbio.02864-23
    CrossRef
  14. Dijk V, “A Central Role for P48 / 45 in Malaria Parasite Male Gamete Fertility,” 2001 vol. 104, pp. 153–164. DOI: 10.1016/S0092-8674(01)00199-4
    CrossRef
  15. Goel S. RIFINs are adhesins implicated in severe Plasmodium falciparum malaria, Nat. Med. 2015; 21( 4): 314–317. Doi- https://www.nature.com/articles/nm.3812
    CrossRef
  16. Yu D, Yang S,  Li Y,  Hu W.Co-expression network with protein–protein interaction and transcription regulation in malaria parasite Plasmodium falciparum. Gene. 2013;518(1): 7-16.Doi-  https://doi.org/10.1016/j.gene.2012.11.092
    CrossRef
  17. Pan H., Lu X, Ye D, Feng Y, Wan, J,Ye, J. The molecular mechanism of thrombospondin family members in cardiovascular diseases. Frontiers in Cardiovascular Medicine. 2024 ; 11(1):  1337586. Doi- https://doi.org/10.3389/fcvm.2024.1337586
    CrossRef
  18. Juillerat A,Lewit A, Guillotte M, Gangnard S, and Hessel A, “Structure of a Plasmodium falciparum PfEMP1 rosetting domain reveals a role for the N-terminal segment in heparin-mediated rosette inhibition,” 2011 vol. 108, no. 13, pp. 5243–5248. https://doi.org/10.1073/pnas.1018692108
    CrossRef
  19. Connor C , Collins K. A Novel RNA Binding Domain in Tetrahymena Telomerase p65 Initiates Hierarchical Assembly of Telomerase Holoenzyme.  2006; 26( 6) :2029–2036. Doi-https://doi.org/10.1128/MCB.26.6.2029-2036.2006
    CrossRef
  20. Das S. Processing of Plasmodium falciparum Merozoite Surface Protein MSP1 Activates a Spectrin-Binding Function Enabling Parasite Egress from RBCs Article Processing of Plasmodium falciparum Merozoite Surface Protein MSP1 Activates a Spectrin-Binding Function Enabling Parasite Egress from RBCs. Cell Host Microbe. 2015;18(4):433–444. Doi-https://doi.org/10.1016/j.chom.2015.09.007
    CrossRef
  21. Yan  H, Feng J, Chen M. Structural modelling prediction of recombinant Plasmodium falciparum K13-F446I and K13-C580Y gene by AlphaFold method and heterologous expression in Spodoptera frugiperda 9 cells. Pathogens.2022;11(11):1271. Doi-https://doi.org/10.3390/pathogens11111271
    CrossRef
  22. Adams J, Thrombospondins: Multifunctional Regulators of Cell Interactions.  Annu. Rev. Cell Dev. Biol. 2001; 17( 1): 25–51, Doi- https://doi.org/10.1146/annurev.cellbio.17.1.25
    CrossRef
  23. Hira F, Islam A,Uddin M, Immunomodulatory and Pharmacological Properties of Catharanthus Roseus: A Comprehensive Review. Letters in Applied Nanobioscience. 2025;14(4):91-106.Doi- https://doi.org/10.33263/LIANBS142.091
  24. Anvikar A, In vitro assessment of drug resistance in Plasmodium falciparum in five States of India.  Indian J. Med. Res. 2012;135(4):  494–499. https://journals.lww.com/ijmr/fulltext/2012/35040 /in_vitro_assessment_of_drug_resistance_in.8.aspx
  25. Chanda E, Integrated vector management : a critical strategy for combating vector-borne diseases in South Sudan. Malaria journal. 2013;12(1):369-378. Doi-  http://www.malariajournal.com/content/ 12/1/369
    CrossRef
  26. Rajput M, Nair V,  Chauhan A, Jawanjal H, Dange V, Evaluation of Antidiarrheal Activity of Aerial Parts of Vinca major in Experimental Animals. Middle East J Sci Res. 2011; 7(5): 784–788. https://www.researchgate.net/profile/Mithun-Rajput/publication/267228391_Evaluation_of_ Antidiarrheal_Activity_of_Aerial_Parts_of_Vinca_major_in_Experimental_Animals/links/546b61b80cf2397f7831bdd3/Evaluation-of-Antidiarrheal-Activity-of-Aerial-Parts-of-Vinca-major-in-Experimental-Animals.pdf
  27. Takthsingji S and hospital G.evaluation of hypolipidemic activity of leaf juice of catharanthus roseus ( linn .) G . Donn . In guinea PIGS. Acta Poloniae. 2011; 68( 6): 927–935. https://ptfarm.pl/pub/File/Acta_Poloniae/2011/6/927.pdf
  28. Mishra J,  Verma N, “A brief study on Catharanthus Roseus : A review,” 2017 vol. 2, no. 2, pp. 20–23. https://www.researchgate.net/profile/Navneet-Verma/publication/319007421_A_brief_study_ on_Catharanthus_Roseus_A_review/links/598ad641aca272435857d010/A-brief-study-on-Catharanthus-Roseus-A-review.pdf
  29. Ramya S, Govindaraji V, Kannan K, Navaneetha, Jayakumararaj R. In Vitro Evaluation of Antibacterial Activity Using Crude Extracts of Catharanthus.  Ethnobot. Leafl. 2008; 12 (1) :  1067–1072. Doi- https://opensiuc.lib.siu.edu/ebl/vol2008/iss1/140/
  30. Salman  M., Qadeer F, Pharmacological Actions and Therapeutic Potential of Trigonella foenum-graecum L. Fenugreek: Biology and applications.  2021;981(16): 523-537. Singapore: Springer Singapore. https://link.springer.com/chapter/10.1007/978-981-16-1197-1_22
    CrossRef
  31. Nayak B, Anderson M, and Pereira P. Evaluation of wound-healing potential of Catharanthus roseus leaf extract in rats. Fitoterapia. 2007; 78(7) : 540–544. Doi- https://doi.org/10.1016/j.fitote. 2007.06.008
    CrossRef
  32. Friesner R,  Extra Precision Glide:  Docking and Scoring Incorporating a Model of Hydrophobic Enclosure for Protein−Ligand Complexes. J. Med. Chem. 2006;  49( 21): 6177–6196. Doi- https://pubs.acs.org/doi/abs/10.1021/jm051256o
    CrossRef
  33. Krieger  E, Joo  K, Lee J, Lee J, Raman S, Thompson J, Karplus K.  Improving physical realism, stereochemistry, and side‐chain accuracy in homology modeling: four approaches that performed well in CASP8. Proteins: Structure, Function, and Bioinformatics, 2016; 77(S9): 114-122. Doi- https://doi.org/10.1080/07391102.2018.1444510
    CrossRef
  34. Kumar S, Singh B, Singh R. Catharanthus roseus (L.) G. Don: A review of its ethnobotany, phytochemistry, ethnopharmacology and toxicities. J. Ethnopharmacol. 2022;  284 (2) :1016-1026.Doi- https://doi.org/10.1016/j.jep.2021.114647
    CrossRef
  35. Ravikumar S, Inbaneson J, Suganthi P, In vitro antiplasmodial activity of ethanolic extracts of South Indian medicinal plants against Plasmodium falciparum, Asian Pacific J. Trop. Dis.2012: 2(3): 180–183. Doi- https://doi.org/10.1016/j.jep.2021.114647
    CrossRef
  36. Joshi  S, Huo C, Budhathoki R, Gurung A, Bhattarai S, Sharma K, Parajuli N. HPLC-ESI-HRMS/MS-Based Metabolite Profiling and Bioactivity Assessment of Catharanthus roseus. Plants.2025;  14(15): 2395-2410. https://doi.org/10.3390/plants14152395
    CrossRef

Article Metrics
PlumX PlumX: 
Views Views:  187 Views
PDF Downloads PDF Downloads:  114

Article Publishing History
Received on: 30-10-2025
Accepted on: 01-12-2025

Article Review Details
Reviewed by: Dr. Bhavesh Hirabhai Patel
Second Review by: Dr. Bidyutparna Bhattacharya Kundu
Final Approval by: Dr. Ali Elshafei


Share

FOLLOW US ON:

facebook Twitter Mendeley LinkedIn

SEARCH WEBSITE

MEMBER OF

Logo-image

JOURNAL ARCHIVED IN

Logo-image